Click to open network menu
Join or Log In
Mobafire logo

Join the leading League of Legends community. Create and share Champion Guides and Builds.

Create an MFN Account






Or

Not Updated For Current Season

This guide has not yet been updated for the current season. Please keep this in mind while reading. You can see the most recently updated guides on the browse guides page

x
Master Yi Build Guide by 2awZ

Master Yi - try it 2 see what happens

Master Yi - try it 2 see what happens

Updated on February 26, 2012
New Guide
Vote Vote
League of Legends Build Guide Author 2awZ Build Guide By 2awZ 1,735 Views 0 Comments
1,735 Views 0 Comments League of Legends Build Guide Author 2awZ Master Yi Build Guide By 2awZ Updated on February 26, 2012
x
Did this guide help you? If so please give them a vote or leave a comment. You can even win prizes by doing so!
Vote
Comment

You must be logged in to comment. Please login or register.

I liked this Guide
I didn't like this Guide
Commenting is required to vote!
Would you like to add a comment to your vote?

Your votes and comments encourage our guide authors to continue
creating helpful guides for the League of Legends community.

Spells:

LoL Summoner Spell: Ignite

Ignite

LoL Summoner Spell: Flash

Flash

Introduction

give it a try ;) i just simply love this champ because .............. is funny ..... so if u folow this built u will get a lot of kills . this will make u their first target so probably u will be fked up :))) so u could buy after infinity edge , the bloodthirster and phantom dancer : frozen mallet, quicksilver( this will hel u a lot agaisnt stuns) i dont want to remember u if ure stuned ure fked up so ............
Back to Top

Runes

greater mark of alacrity - i buy it because gives you the most attack speed
greater seal of furor - this will help you a lot after u buy infinity edge
greater glyph of furor - the same
greater quintessence of might u need dmg
Back to Top

Masteries

probably is mad to play 30-0 at that built and runes so if you dont want to play at risk you can try 20-10-0 or 10-20-0
Back to Top

Skill Sequence

ALPHA STRYKE - is good at start when you are not so powerful
MEDIATE - is good to rezist more in battler or in critical situations when the opponent use ingite on you and you sure die you can use it and survive
WUJU STYLE - first skill that must have max lv is very important
HIGHLANDER - use it just when you know you can get a kill or to escape ( if u cant get a kill you just waste your ulti
Back to Top

Items

DORAN'S BLADE - the best start items for me because it gives you health damage and a few life steal
BERSEKER'S GREAVES - the best boots for master yi
VAMPIRIC SCEPTER -you can rezist more and farm more
B.F SWORD - the best starting item when you want to buy infinity edge
INFINITY EDGE - this gives you attack damage and critic chace ( runes will help you a lot )
PHANTOM DANCER - this gives you attack speed and critic chance
THE BLOODTHIRSTER - this gives you survivability
Back to Top

Summoner Spells

CLAIRVOYANCE - your are not a support
EXHAUST - good if you dont want to run to much for a kill =))
IGNITE - good for finishing if you have no chance to hit him again
FLASH - good for ecaping and for pick up the kills
GHOST - i dont know what to say about this summoner skill ( you have your ulti :D )
CLEANSE - this will help a lot agaisnt stuners ( if you are stuned you are fked up )
SMITE - master yi is a good jungler ( if you want to play as a jungler start with cloth armor and 5 health potions then buy vampiric , berseker's greaves and then the same built .................)
Back to Top

so..

i need 5000 letters so lets go : aksdsdsdsdsdsdsdsdjhdfsb kdsjk dsjfl ldfjsljf,jaskj slfjkjalksdlajd sdoalalalalalalaljdfddddddddddddddddddddddlaklskl aojdojaod oaddjjjjjjjjjjda jakdjkkkkkkkkk akdjjjjjkajkaituri wtjhiojhwo wotjowwwwwwwwwwwwwwwwwwwwwndsfdkn akaheiwhdnws,l wijsjfk skrhinwm slrjrlw,w, hsjw feuabg wdgdugw wugeuwgw bdgromaniadjhsdgf uwgruuuuuuuuu sgddddddddddddddddddddddddddddsjghajuyejjdhhasjjaeute =)))))))) fdhjjjjjjjjjjjjjjsdbggag fdddgfdfddrrrrrrrrrrrrrddderrfdddeerftffgrrrrrrrrrrrrreeeeewwsssvfrted fdtddrdrsewas fcderrfffddddffffffffffffffffffffffffffffffffffffffdddddrrrrrrrrrrrrrrrrrrrrrrrrrrrdffffffffffffffffffffccdccccccccrrrrrrrrrrrrrrrrrrrrrrrrrrrrdddddddddvffgggggggggggddddddddddddesrfdfcgrrdswaesdxcfcxxxxxxxxxdzzaqazwsxedcddddddssssssswadreedddeerdfrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrdddddddddddddddddddddddddddddddddddddddddddfccccccccccccccfcccccccvvfffffffffsededededededededededededededededededededededededdddddddddddddddddddddfcfccccccxsxxxxxxxxxxxxxxddddddgggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggffffffffffffffffffffffffffffffffffdfffffffddfcccxdddddffffdddddddddddddddddddddfffffffserrrrrreecfcffffgbvvvvvghytrrrrrrrrrccccccccccccxdwaqqazsxxddxxxxxqaesseessdsxxaaaaxsszsszxzxccfrrewasdeqqweqwwewewqwsaszzxsdcftreyhhnvvvvvvvvvfssqqaswdsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxddwsxdrewwsewsxwwsxwsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewswsxdrewsxdrwsxdawzqazwsxdcrrrdfdccxeswqaazsxdrertfcxdxzqazsdcxzasdewqaqazwseddddddcfrdssssssssssssssssssdddddddddxcccxxzsaqqwssesddcxszz dswsdsssswaawqaazazweqrweeeewejkefsjaafjdjk so probably i get 5000 letters sry for seeing this but .......k if u liked this built or not plz leave a comemnt i hope that this help u ( good luck :) )
Download the Porofessor App for Windows
League of Legends Build Guide Author 2awZ
2awZ Master Yi Guide
Vote Vote
Master Yi - try it 2 see what happens

League of Legends Champions:

Teamfight Tactics Guide