Mobafire League of Legends Build Guides Mobafire League of Legends Build Guides

Master Yi Build Guide by 2awZ

Not Updated For Current Season

This guide has not yet been updated for the current season. Please keep this in mind while reading. You can see the most recently updated guides on the browse guides page.

Rating Pending
League of Legends Build Guide Author 2awZ

Master Yi - try it 2 see what happens

2awZ Last updated on February 26, 2012
Like Build on Facebook Tweet This Build Share This Build on Reddit

Ability Sequence

Ability Key Q
Ability Key W
Ability Key E
Ability Key R

Not Updated For Current Season

The masteries shown here are not yet updated for the current season, the guide author needs to set up the new masteries. As such, they will be different than the masteries you see in-game.



Offense: 30

Honor Guard

Defense: 0

Strength of Spirit

Utility: 0

Guide Top


give it a try ;) i just simply love this champ because .............. is funny ..... so if u folow this built u will get a lot of kills . this will make u their first target so probably u will be fked up :))) so u could buy after infinity edge , the bloodthirster and phantom dancer : frozen mallet, quicksilver( this will hel u a lot agaisnt stuns) i dont want to remember u if ure stuned ure fked up so ............

Guide Top


greater mark of alacrity - i buy it because gives you the most attack speed
greater seal of furor - this will help you a lot after u buy infinity edge
greater glyph of furor - the same
greater quintessence of might u need dmg

Guide Top


probably is mad to play 30-0 at that built and runes so if you dont want to play at risk you can try 20-10-0 or 10-20-0

Guide Top

Skill Sequence

ALPHA STRYKE - is good at start when you are not so powerful
MEDIATE - is good to rezist more in battler or in critical situations when the opponent use ingite on you and you sure die you can use it and survive
WUJU STYLE - first skill that must have max lv is very important
HIGHLANDER - use it just when you know you can get a kill or to escape ( if u cant get a kill you just waste your ulti

Guide Top


DORAN'S BLADE - the best start items for me because it gives you health damage and a few life steal
BERSEKER'S GREAVES - the best boots for master yi
VAMPIRIC SCEPTER -you can rezist more and farm more
B.F SWORD - the best starting item when you want to buy infinity edge
INFINITY EDGE - this gives you attack damage and critic chace ( runes will help you a lot )
PHANTOM DANCER - this gives you attack speed and critic chance
THE BLOODTHIRSTER - this gives you survivability

Guide Top

Summoner Spells

CLAIRVOYANCE - your are not a support
EXHAUST - good if you dont want to run to much for a kill =))
IGNITE - good for finishing if you have no chance to hit him again
FLASH - good for ecaping and for pick up the kills
GHOST - i dont know what to say about this summoner skill ( you have your ulti :D )
CLEANSE - this will help a lot agaisnt stuners ( if you are stuned you are fked up )
SMITE - master yi is a good jungler ( if you want to play as a jungler start with cloth armor and 5 health potions then buy vampiric , berseker's greaves and then the same built .................)

Guide Top


i need 5000 letters so lets go : aksdsdsdsdsdsdsdsdjhdfsb kdsjk dsjfl ldfjsljf,jaskj slfjkjalksdlajd sdoalalalalalalaljdfddddddddddddddddddddddlaklskl aojdojaod oaddjjjjjjjjjjda jakdjkkkkkkkkk akdjjjjjkajkaituri wtjhiojhwo wotjowwwwwwwwwwwwwwwwwwwwwndsfdkn akaheiwhdnws,l wijsjfk skrhinwm slrjrlw,w, hsjw feuabg wdgdugw wugeuwgw bdgromaniadjhsdgf uwgruuuuuuuuu sgddddddddddddddddddddddddddddsjghajuyejjdhhasjjaeute =)))))))) fdhjjjjjjjjjjjjjjsdbggag fdddgfdfddrrrrrrrrrrrrrddderrfdddeerftffgrrrrrrrrrrrrreeeeewwsssvfrted fdtddrdrsewas fcderrfffddddffffffffffffffffffffffffffffffffffffffdddddrrrrrrrrrrrrrrrrrrrrrrrrrrrdffffffffffffffffffffccdccccccccrrrrrrrrrrrrrrrrrrrrrrrrrrrrdddddddddvffgggggggggggddddddddddddesrfdfcgrrdswaesdxcfcxxxxxxxxxdzzaqazwsxedcddddddssssssswadreedddeerdfrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrrdddddddddddddddddddddddddddddddddddddddddddfccccccccccccccfcccccccvvfffffffffsededededededededededededededededededededededededdddddddddddddddddddddfcfccccccxsxxxxxxxxxxxxxxddddddgggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggggffffffffffffffffffffffffffffffffffdfffffffddfcccxdddddffffdddddddddddddddddddddfffffffserrrrrreecfcffffgbvvvvvghytrrrrrrrrrccccccccccccxdwaqqazsxxddxxxxxqaesseessdsxxaaaaxsszsszxzxccfrrewasdeqqweqwwewewqwsaszzxsdcftreyhhnvvvvvvvvvfssqqaswdsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxddwsxdrewwsewsxwwsxwsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewsxdrewswsxdrewsxdrwsxdawzqazwsxdcrrrdfdccxeswqaazsxdrertfcxdxzqazsdcxzasdewqaqazwseddddddcfrdssssssssssssssssssdddddddddxcccxxzsaqqwssesddcxszz dswsdsssswaawqaazazweqrweeeewejkefsjaafjdjk so probably i get 5000 letters sry for seeing this but .......k if u liked this built or not plz leave a comemnt i hope that this help u ( good luck :) )